PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 226aa    MW: 25600.7 Da    PI: 6.2459
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018546genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ ++ ++G ++W++ ++  g++R++k+c++rw++yl
      Lus10018546 14 KGTWTPEEDMRLAAYISRYGCRNWRRLPEDAGLKRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding45.81.5e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T++E+  ++ ++++lG++ W+ Ia +m  gRt++++k+ w+++l
      Lus10018546  67 RGGFTKDEEATILALHEKLGNK-WSIIATHMS-GRTDNEIKNLWNTHL 112
                      788*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.775961IPR017930Myb domain
SuperFamilySSF466897.86E-2911108IPR009057Homeodomain-like
SMARTSM007176.0E-121363IPR001005SANT/Myb domain
PfamPF002495.7E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-231568IPR009057Homeodomain-like
CDDcd001678.77E-101661No hitNo description
PROSITE profilePS5129423.84562116IPR017930Myb domain
SMARTSM007172.4E-1266114IPR001005SANT/Myb domain
PfamPF002497.2E-1367112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2469114IPR009057Homeodomain-like
CDDcd001671.59E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MARTPYVDRN GLKKGTWTPE EDMRLAAYIS RYGCRNWRRL PEDAGLKRCG KSCRLRWLNY  60
LRPDIKRGGF TKDEEATILA LHEKLGNKWS IIATHMSGRT DNEIKNLWNT HLRKLQPPVE  120
LQKEATCSNI DAVDDHHSPQ QISAGSNASS GTSCVAADQA MSISRSVAPT GNDEVLISDD  180
FWSQPFLPYG EDIDQGTEAY GTSGDEFQME REMLWFYHAL MNYSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241211425126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325681.19e-60hypothetical protein POPTR_0019s14140g
SwissprotQ7XBH44e-53MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLB9INU31e-59B9INU3_POPTR; Uncharacterized protein
STRINGPOPTR_0019s14140.13e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.16e-55myb domain protein 93